PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG023213.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SRS
Protein Properties Length: 364aa    MW: 37840.7 Da    PI: 8.017
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG023213.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022112.9e-651483073154
       DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkel 100
                  s t++C+dCGnqakkdC+h+RCRtCCksrgfdCathvkstWv+aa+rrerq   a+a   a ++ +++ sk++r   +++++++s+t++s+++++++ 
  CCG023213.1 148 SATTTCEDCGNQAKKDCSHRRCRTCCKSRGFDCATHVKSTWVAAARRRERQLI-ATAGGGAGSTGSTSGSKKPRLI-NSQTTTTSHTSTSNTTPPRSY 243
                  57899********************************************9655.4555666777788999999975.788899999************ PP

       DUF702 101 etss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                  +tss          lP +v ++avfrcvrv++v+dge+e+aYq++v+igGhvfkG+LydqG+e+
  CCG023213.1 244 DTSSshqdagfkerLPVQVTAPAVFRCVRVTAVEDGEDEYAYQAVVKIGGHVFKGFLYDQGVET 307
                  *9999********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.5E-60150306IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.3E-25152194IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016248.6E-29257305IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
IGMVGLRDVF VVAPAAPFQH HPHPPHPPPP HQHNEQINLS TADPINASNA TALGVGVGVG  60
VIPLLTSAPC LTPQNMDDQD LLHNGRNKIG GIHQFWQNQG SQYIKKASDT TPSIIDHHNN  120
SSTANLLLQS GSGGGNGSGN LGGNSSSSAT TTCEDCGNQA KKDCSHRRCR TCCKSRGFDC  180
ATHVKSTWVA AARRRERQLI ATAGGGAGST GSTSGSKKPR LINSQTTTTS HTSTSNTTPP  240
RSYDTSSSHQ DAGFKERLPV QVTAPAVFRC VRVTAVEDGE DEYAYQAVVK IGGHVFKGFL  300
YDQGVETRDG FPNISELHLG AANGGGGGTG RHGASSTPIL DPSDVYGASA GGFLGGSAFG  360
NPIN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011024965.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like isoform X2
SwissprotQ94CK92e-86LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLB9GG871e-173B9GG87_POPTR; Uncharacterized protein
STRINGPOPTR_0001s28290.11e-173(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.24e-70Lateral root primordium (LRP) protein-related